Gamma Tubulin 2 antibody (70R-4513)

Rabbit polyclonal Gamma Tubulin 2 antibody raised against the middle region of TUBG2

Synonyms Polyclonal Gamma Tubulin 2 antibody, Anti-Gamma Tubulin 2 antibody, MGC131994 antibody, TUBG2 antibody
Specificity Gamma Tubulin 2 antibody was raised against the middle region of TUBG2
Cross Reactivity Human
Applications WB
Immunogen Gamma Tubulin 2 antibody was raised using the middle region of TUBG2 corresponding to a region with amino acids FDKLRKRDAFLEQFRKEDMFKDNFDEMDRSREVVQELIDEYHAATQPDYI
Assay Information Gamma Tubulin 2 Blocking Peptide, catalog no. 33R-2866, is also available for use as a blocking control in assays to test for specificity of this Gamma Tubulin 2 antibody

Images

Western Blot analysis using Gamma Tubulin 2 antibody (70R-4513)

Gamma Tubulin 2 antibody (70R-4513) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TUBG2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Tubulin is the major constituent of microtubules. Gamma tubulin is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome, suggesting that it is involved in the minus-end nucleation of microtubule assembly.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Gamma Tubulin 2 antibody (70R-4513) | Gamma Tubulin 2 antibody (70R-4513) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors