GANC antibody (70R-4273)

Rabbit polyclonal GANC antibody raised against the middle region of GANC

Synonyms Polyclonal GANC antibody, Anti-GANC antibody, Glucosidase Alpha; Neutral C antibody, MGC138256 antibody
Specificity GANC antibody was raised against the middle region of GANC
Cross Reactivity Human
Applications WB
Immunogen GANC antibody was raised using the middle region of GANC corresponding to a region with amino acids VLGFRKEPSSVTTHSSDGKDQPVAFTYCAKTSILSLEKLSLNIATDWEVR
Assay Information GANC Blocking Peptide, catalog no. 33R-9658, is also available for use as a blocking control in assays to test for specificity of this GANC antibody

Images

Western Blot analysis using GANC antibody (70R-4273)

GANC antibody (70R-4273) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 104 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GANC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GANC has alpha-glucosidase activity.Glycosyl hydrolase enzymes hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GANC antibody (70R-4273) | GANC antibody (70R-4273) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors