GAPDH antibody (70R-2302)

Rabbit polyclonal GAPDH antibody raised against the middle region of GAPDH

Synonyms Polyclonal GAPDH antibody, Anti-GAPDH antibody, GAPD antibody, G3PD antibody, MGC88685 antibody, Glyceraldehyde-3-Phosphate Dehydrogenase antibody
Specificity GAPDH antibody was raised against the middle region of GAPDH
Cross Reactivity Human,Mouse
Applications WB
Immunogen GAPDH antibody was raised using the middle region of GAPDH corresponding to a region with amino acids KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC
Assay Information GAPDH Blocking Peptide, catalog no. 33R-4239, is also available for use as a blocking control in assays to test for specificity of this GAPDH antibody

Images

Western Blot analysis using GAPDH antibody (70R-2302)

GAPDH antibody (70R-2302) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GAPDH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD).

References
Add a Paper

Etsushi Kuroda, Ken J. Ishii, Satoshi Uematsu, Keiichi Ohata, Cevayir Coban, Shizuo Akira, Kosuke Aritake, Yoshihiro Urade, Yasuo Morimoto

Silica Crystals and Aluminum Salts Regulate the Production of Prostaglandin in Macrophages via NALP3 Inflammasome-Independent Mechanisms

Immunity

Volume: 34 Issue: 4 Page: 514-526 DOI: 10.1016/j.immuni.2011.03.019

Takashi Matsumotoa, Hiroshi Takahashia, Daisuke Shivab, Noriaki Kawanishia, Michael J. Kremenika, Yasuko Katoc, Hiromi Yano

The reduction of voluntary physical activity after poly I:C injection is independent of the effect of poly I:C-induced interferon-beta in mice

Physiology & Behavior

Volume: 93 Issue: 4-5 Page: 835-841 DOI: 10.1016/j.physbeh.2007.11.048

Joerg Heinekea, b, Kai C. Wollertb, Hanna Osinskaa, Michelle A. Sargenta, Allen J. Yorka, Jeffrey Robbinsa, Jeffery D. Molkentin

Calcineurin protects the heart in a murine model of dilated cardiomyopathy

Journal of Molecular and Cellular Cardiology

Volume: 48 Issue: 6 Page: 1080-1087 DOI: 10.1016/j.yjmcc.2009.10.012

Jianjian Shia, Yi-Wei Zhanga, Yu Yanga, Lumin Zhanga, Lei Wei

ROCK1 plays an essential role in the transition from cardiac hypertrophy to failure in mice

Journal of Molecular and Cellular Cardiology

Volume: 49 Issue: 5 Page: 819-828 DOI: 10.1016/j.yjmcc.2010.08.008

Weimin Kong, Jui-Hung Yen, Evros Vassiliou, Sabina Adhikary, Miguel G Toscano, Doina Ganea

Docosahexaenoic acid prevents dendritic cell maturation and in vitro and in vivo expression of the IL-12 cytokine family

Lipids in Health and Disease

Issue: 9:12 DOI: 10.1186/1476-511X-9-12

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GAPDH antibody (70R-2302) | GAPDH antibody (70R-2302) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors