GART antibody (70R-4053)

Rabbit polyclonal GART antibody raised against the middle region of GART

Synonyms Polyclonal GART antibody, Anti-GART antibody, PRGS antibody, GARS antibody, PGFT antibody, Phosphoribosylglycinamide Formyltransferase Phosphoribosylglycinamide Synthetase Phosphoribosylaminoimidazole Synthetase antibody, GARTF antibody, PAIS antibody, AIRS antibody, MGC47764 antibody
Specificity GART antibody was raised against the middle region of GART
Cross Reactivity Human
Applications WB
Immunogen GART antibody was raised using the middle region of GART corresponding to a region with amino acids VLKNGSLTNHFSFEKKKARVAVLISGTGSNLQALIDSTREPNSSAQIDIV
Assay Information GART Blocking Peptide, catalog no. 33R-9669, is also available for use as a blocking control in assays to test for specificity of this GART antibody


Western Blot analysis using GART antibody (70R-4053)

GART antibody (70R-4053) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 108 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GART antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a trifunctional polypeptide. It has phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase activity which is required for de novo purine biosynthesis. This enzyme is highly conserved in vertebrates. Alternative splicing of this gene results in two transcript variants encoding different isoforms.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GART antibody (70R-4053) | GART antibody (70R-4053) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors