GAS8 antibody (70R-3968)

Rabbit polyclonal GAS8 antibody raised against the N terminal of GAS8

Synonyms Polyclonal GAS8 antibody, Anti-GAS8 antibody, MGC138326 antibody, Growth Arrest-Specific 8 antibody, GAS11 antibody
Specificity GAS8 antibody was raised against the N terminal of GAS8
Cross Reactivity Human
Applications WB
Immunogen GAS8 antibody was raised using the N terminal of GAS8 corresponding to a region with amino acids VSRIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREM
Assay Information GAS8 Blocking Peptide, catalog no. 33R-9820, is also available for use as a blocking control in assays to test for specificity of this GAS8 antibody


Western Blot analysis using GAS8 antibody (70R-3968)

GAS8 antibody (70R-3968) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GAS8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene includes 11 exons spanning 25 kb and maps to a region of chromosome 16 that is sometimes deleted in breast and prostrate cancer. The second intron contains an apparently intronless gene, C16orf3, that is transcribed in the opposite orientation. This gene is a putative tumor suppressor gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GAS8 antibody (70R-3968) | GAS8 antibody (70R-3968) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
View Our Distributors