GBL antibody (70R-3342)

Rabbit polyclonal GBL antibody

Synonyms Polyclonal GBL antibody, Anti-GBL antibody, Glioblastoma antibody, MGC111011 antibody
Cross Reactivity Human
Applications WB
Immunogen GBL antibody was raised using a synthetic peptide corresponding to a region with amino acids CAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVL
Assay Information GBL Blocking Peptide, catalog no. 33R-1639, is also available for use as a blocking control in assays to test for specificity of this GBL antibody

Images

Western Blot analysis using GBL antibody (70R-3342)

GBL antibody (70R-3342) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GBL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GBL is the subunit of both mTORC1 and mTORC2, which regulate cell growth and survival in response to nutrient and hormonal signals. mTORC1 is activated in response to growth factors or amino-acids. Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. mTORC2 seems to function upstream of Rho GTPases to regulate the actin cytoskeleton, probably by activating one or more Rho-type guanine nucleotide exchange factors. mTORC2 promotes the serum-induced formation of stress-fibers or F-actin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GBL antibody (70R-3342) | GBL antibody (70R-3342) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors