GCK Blocking Peptide (33R-10396)

A synthetic peptide for use as a blocking control in assays to test for specificity of GCK antibody, catalog no. 70R-10324

Synonyms GCK control peptide, GCK antibody Blocking Peptide, Anti-GCK Blocking Peptide, glucokinase, hexokinase 4 Blocking Peptide, FGQTL3 Blocking Peptide, GK Blocking Peptide, GLK Blocking Peptide, HHF3 Blocking Peptide, HK4 Blocking Peptide, HKIV Blocking Peptide, HXKP Blocking Peptide, MODY2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEMLFDYISECISDFL
Molecular Weight 51 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. Alternative splicing of this gene results in three tissue-specific forms of glucokinase, one found in pancreatic islet beta cells and two found in liver. The protein localizes to the outer membrane of mitochondria. In contrast to other forms of hexokinase, this enzyme is not inhibited by its product glucose-6-phosphate but remains active while glucose is abundant. Mutations in this gene have been associated with non-insulin dependent diabetes mellitus (NIDDM), maturity onset diabetes of the young, type 2 (MODY2) and persistent hyperinsulinemic hypoglycemia of infancy (PHHI).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors