GCLM antibody (70R-3355)

Rabbit polyclonal GCLM antibody raised against the middle region of GCLM

Synonyms Polyclonal GCLM antibody, Anti-GCLM antibody, GLCLR antibody, Glutamate-Cysteine Ligase Modifier Subunit antibody
Specificity GCLM antibody was raised against the middle region of GCLM
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GCLM antibody was raised using the middle region of GCLM corresponding to a region with amino acids KPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQ
Assay Information GCLM Blocking Peptide, catalog no. 33R-4592, is also available for use as a blocking control in assays to test for specificity of this GCLM antibody

Images

Western blot analysis using GCLM antibody (70R-3355)

Recommended GCLM Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GCLM antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia.Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using GCLM antibody (70R-3355) | Recommended GCLM Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using GCLM antibody (70R-3355) | Liver
  • Western blot analysis using GCLM antibody (70R-3355) | Lanes:  1: 40ug mouse heart lysate, 2: 40ug mouse heart lysate; GCLM antibody at 1:500

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors