GCNT4 antibody (70R-7414)

Rabbit polyclonal GCNT4 antibody

Synonyms Polyclonal GCNT4 antibody, Anti-GCNT4 antibody, Glucosaminyl antibody, C2GNT3 antibody, N-Acetyl Transferase 4 Core 2 antibody
Cross Reactivity Human,Dog
Applications WB
Immunogen GCNT4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SKDTYSPDEHFWATLIRVPGIPGEISRSAQDVSDLQSKTRLVKWNYYEGF
Assay Information GCNT4 Blocking Peptide, catalog no. 33R-8548, is also available for use as a blocking control in assays to test for specificity of this GCNT4 antibody

Images

Western Blot analysis using GCNT4 antibody (70R-7414)

GCNT4 antibody (70R-7414) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GCNT4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GCNT4 is a glycosyltransferase that mediates core 2 O-glycan branching, an important step in mucin-type biosynthesis. It does not have core 4 O-glycan or I-branching enzyme activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GCNT4 antibody (70R-7414) | GCNT4 antibody (70R-7414) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors