GDAP1L1 antibody (70R-6552)

Rabbit polyclonal GDAP1L1 antibody raised against the N terminal of GDAP1L1

Synonyms Polyclonal GDAP1L1 antibody, Anti-GDAP1L1 antibody, dJ995J12.1.1 antibody, Ganglioside-Induced Differentiation-Associated Protein 1-Like 1 antibody, dJ881L22.1 antibody, DKFZp761K228 antibody
Specificity GDAP1L1 antibody was raised against the N terminal of GDAP1L1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GDAP1L1 antibody was raised using the N terminal of GDAP1L1 corresponding to a region with amino acids ERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFT
Assay Information GDAP1L1 Blocking Peptide, catalog no. 33R-2689, is also available for use as a blocking control in assays to test for specificity of this GDAP1L1 antibody

Images

Western Blot analysis using GDAP1L1 antibody (70R-6552)

GDAP1L1 antibody (70R-6552) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GDAP1L1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The ganglioside GD3 synthase causes cell differentiation with neurite sprouting when transfected into the mouse neuroblastoma cell line Neuro2a. After differentiation, the expression of several genes is upregulated, including one that encodes a protein termed ganglioside-induced differentiation-associated protein 1 (Gdap1). A similar gene was found in humans, and mutations in the human gene are associated with Charcot-Marie-Tooth type 4A disease. GDAP1L1 is similar in sequence to the human GDAP1 protein.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GDAP1L1 antibody (70R-6552) | GDAP1L1 antibody (70R-6552) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors