GDE1 antibody (70R-7477)

Rabbit polyclonal GDE1 antibody raised against the N terminal Of Gde1

Synonyms Polyclonal GDE1 antibody, Anti-GDE1 antibody, 363E6.2 antibody, GDE1 antibody
Specificity GDE1 antibody was raised against the N terminal Of Gde1
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen GDE1 antibody was raised using the N terminal Of Gde1 corresponding to a region with amino acids LRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKN
Assay Information GDE1 Blocking Peptide, catalog no. 33R-5401, is also available for use as a blocking control in assays to test for specificity of this GDE1 antibody

Images

Immunohistochemical staining using GDE1 antibody (70R-7477)

GDE1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GDE1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GDE1 has glycerophosphoinositol phosphodiesterase activity. It has little or no activity towards glycerophosphocholine. GDE1 activity can be modulated by G-protein signaling pathways.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using GDE1 antibody (70R-7477) | GDE1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X
  • Western Blot analysis using GDE1 antibody (70R-7477) | GDE1 antibody (70R-7477) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors