GDF15 antibody (70R-6225)

Rabbit polyclonal GDF15 antibody raised against the N terminal of GDF15

Synonyms Polyclonal GDF15 antibody, Anti-GDF15 antibody, PDF antibody, GDF-15, PTGFB antibody, MIC1 antibody, PLAB antibody, GDF15, NAG-1 antibody, GDF 15, GDF-15 antibody, Growth Differentiation Factor 15 antibody, GDF 15 antibody, MIC-1 antibody, GDF-15 antibody
Specificity GDF15 antibody was raised against the N terminal of GDF15
Cross Reactivity Human
Applications WB
Immunogen GDF15 antibody was raised using the N terminal of GDF15 corresponding to a region with amino acids ASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAP
Assay Information GDF15 Blocking Peptide, catalog no. 33R-1525, is also available for use as a blocking control in assays to test for specificity of this GDF15 antibody


Western Blot analysis using GDF15 antibody (70R-6225)

GDF15 antibody (70R-6225) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GDF15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Bone morphogenetic proteins are members of the transforming growth factor-beta superfamily and regulate tissue differentiation and maintenance.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GDF15 antibody (70R-6225) | GDF15 antibody (70R-6225) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors