GDF2 antibody (70R-6213)

Rabbit polyclonal GDF2 antibody raised against the middle region of GDF2

Synonyms Polyclonal GDF2 antibody, Anti-GDF2 antibody, GDF 2 antibody, GDF-2 antibody, BMP9 antibody, GDF2, GDF 2, BMP-9 antibody, Growth Differentiation Factor 2 antibody, GDF-2
Specificity GDF2 antibody was raised against the middle region of GDF2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GDF2 antibody was raised using the middle region of GDF2 corresponding to a region with amino acids CFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDM
Assay Information GDF2 Blocking Peptide, catalog no. 33R-1682, is also available for use as a blocking control in assays to test for specificity of this GDF2 antibody

Images

Western Blot analysis using GDF2 antibody (70R-6213)

GDF2 antibody (70R-6213) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GDF2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GDF2 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Studies in rodents suggest that this protein plays a role in the adult liver and in differentiation of cholinergic central nervous system neurons.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GDF2 antibody (70R-6213) | GDF2 antibody (70R-6213) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors