GFOD1 antibody (70R-3804)

Rabbit polyclonal GFOD1 antibody raised against the middle region of GFOD1

Synonyms Polyclonal GFOD1 antibody, Anti-GFOD1 antibody, GFOD 1, Glucose-Fructose Oxidoreductase Domain Containing 1 antibody, GFOD 1 antibody, GFOD1, GFOD-1, GFOD-1 antibody
Specificity GFOD1 antibody was raised against the middle region of GFOD1
Cross Reactivity Human
Applications WB
Immunogen GFOD1 antibody was raised using the middle region of GFOD1 corresponding to a region with amino acids NSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAAT
Assay Information GFOD1 Blocking Peptide, catalog no. 33R-6883, is also available for use as a blocking control in assays to test for specificity of this GFOD1 antibody

Images

Western Blot analysis using GFOD1 antibody (70R-3804)

GFOD1 antibody (70R-3804) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GFOD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of GFOD1 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GFOD1 antibody (70R-3804) | GFOD1 antibody (70R-3804) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors