GGA3 antibody (70R-3125)

Rabbit polyclonal GGA3 antibody raised against the N terminal of GGA3

Synonyms Polyclonal GGA3 antibody, Anti-GGA3 antibody, GGA-3, GGA3, Golgi Associated Gamma Adaptin Ear Containing Arf Binding Protein 3 antibody, KIAA0154 antibody, GGA 3 antibody, GGA 3, GGA-3 antibody
Specificity GGA3 antibody was raised against the N terminal of GGA3
Cross Reactivity Human
Applications WB
Immunogen GGA3 antibody was raised using the N terminal of GGA3 corresponding to a region with amino acids AKLLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLL
Assay Information GGA3 Blocking Peptide, catalog no. 33R-1301, is also available for use as a blocking control in assays to test for specificity of this GGA3 antibody

Images

Western Blot analysis using GGA3 antibody (70R-3125)

GGA3 antibody (70R-3125) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 78 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GGA3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) family. This family includes ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GGA3 antibody (70R-3125) | GGA3 antibody (70R-3125) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors