GGCX antibody (70R-6289)

Rabbit polyclonal GGCX antibody raised against the middle region of GGCX

Synonyms Polyclonal GGCX antibody, Anti-GGCX antibody, Gamma-Glutamyl Carboxylase antibody, FLJ26629 antibody, VKCFD1 antibody
Specificity GGCX antibody was raised against the middle region of GGCX
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GGCX antibody was raised using the middle region of GGCX corresponding to a region with amino acids FLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGE
Assay Information GGCX Blocking Peptide, catalog no. 33R-2973, is also available for use as a blocking control in assays to test for specificity of this GGCX antibody

Images

Western Blot analysis using GGCX antibody (70R-6289)

GGCX antibody (70R-6289) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 87 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GGCX antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GGCX is an enzyme which catalyzes the posttranslational modification of vitamin K-dependent protein. Many of these vitamin K-dependent proteins are involved in coagulation so the function of the encoded enzyme is essential for hemostasis. Mutations in this gene are associated with vitamin K-dependent coagulation defect and PXE-like disorder with multiple coagulation factor deficiency.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GGCX antibody (70R-6289) | GGCX antibody (70R-6289) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors