GGTLA4 antibody (70R-1298)

Rabbit polyclonal GGTLA4 antibody raised against the C terminal of GGTLA4

Synonyms Polyclonal GGTLA4 antibody, Anti-GGTLA4 antibody, GGTLA-4 antibody, dJ831C21.2 antibody, GGTLA 4 antibody, GGTLA-4, RP5-831C21.2 antibody, GGTLA 4, GGTLA4, Gamma-Glutamyltransferase-Like Activity 4 antibody, MGC50550 antibody
Specificity GGTLA4 antibody was raised against the C terminal of GGTLA4
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen GGTLA4 antibody was raised using the C terminal of GGTLA4 corresponding to a region with amino acids DQEVTAALETRHHHTQITSTFIAVVQAIVRMAGGWAAASDSRKGGEPAGY
Assay Information GGTLA4 Blocking Peptide, catalog no. 33R-2128, is also available for use as a blocking control in assays to test for specificity of this GGTLA4 antibody


Immunohistochemical staining using GGTLA4 antibody (70R-1298)

GGTLA4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GGTLA4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Gamma-glutamyl transpeptidase is a membrane-bound protein that is important in the metabolism of glutathione. The protein is similar in sequence to several members of the gamma-glutamyl transpeptidase family.Gamma-glutamyl transpeptidase is a membrane-bound protein that is important in the metabolism of glutathione.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using GGTLA4 antibody (70R-1298) | GGTLA4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using GGTLA4 antibody (70R-1298) | GGTLA4 antibody (70R-1298) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors