GHR antibody (70R-7290)

Rabbit polyclonal GHR antibody raised against the N terminal of GHR

Synonyms Polyclonal GHR antibody, Anti-GHR antibody, Growth Hormone Receptor antibody, GHBP antibody
Specificity GHR antibody was raised against the N terminal of GHR
Cross Reactivity Human
Applications WB
Immunogen GHR antibody was raised using the N terminal of GHR corresponding to a region with amino acids LQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLF
Assay Information GHR Blocking Peptide, catalog no. 33R-5341, is also available for use as a blocking control in assays to test for specificity of this GHR antibody

Images

Western Blot analysis using GHR antibody (70R-7290)

GHR antibody (70R-7290) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GHR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GHR is a protein that is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal transduction pathway leading to growth. A common alternate allele of this gene, called GHRd3, lacks exon three and has been well-characterized. Mutations in this gene have been associated with Laron syndrome, also known as the growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GHR antibody (70R-7290) | GHR antibody (70R-7290) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors