GHRHR antibody (70R-7057)

Rabbit polyclonal GHRHR antibody raised against the C terminal of GHRHR

Synonyms Polyclonal GHRHR antibody, Anti-GHRHR antibody, GHRFR antibody, Growth Hormone Releasing Hormone Receptor antibody, GHRHRpsv antibody, GRFR antibody
Specificity GHRHR antibody was raised against the C terminal of GHRHR
Cross Reactivity Human
Applications WB
Immunogen GHRHR antibody was raised using the C terminal of GHRHR corresponding to a region with amino acids YWWIIKGPIVLSVGVNFGLFLNIIRILVRKLEPAQGSLHTQSQYWYCVFV
Assay Information GHRHR Blocking Peptide, catalog no. 33R-10294, is also available for use as a blocking control in assays to test for specificity of this GHRHR antibody


Western Blot analysis using GHRHR antibody (70R-7057)

GHRHR antibody (70R-7057) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GHRHR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GHRHR is a receptor for growth hormone-releasing hormone. Binding of this hormone to the receptor leads to synthesis and release of growth hormone. Mutations in its gene have been associated with isolated growth hormone deficiency (IGHD), also known as Dwarfism of Sindh, a disorder characterized by short stature.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GHRHR antibody (70R-7057) | GHRHR antibody (70R-7057) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors