GIMAP5 antibody (70R-6383)

Rabbit polyclonal GIMAP5 antibody raised against the middle region of GIMAP5

Synonyms Polyclonal GIMAP5 antibody, Anti-GIMAP5 antibody, IAN4L1 antibody, GIMAP 5 antibody, IAN4 antibody, FLJ11296 antibody, GIMAP5, Gtpase Imap Family Member 5 antibody, IAN5 antibody, GIMAP-5, HIMAP3 antibody, IMAP3 antibody, hIAN5 antibody, GIMAP-5 antibody, GIMAP 5
Specificity GIMAP5 antibody was raised against the middle region of GIMAP5
Cross Reactivity Human
Applications WB
Immunogen GIMAP5 antibody was raised using the middle region of GIMAP5 corresponding to a region with amino acids CERRYCAFNNWGSVEEQRQQQAELLAVIERLGREREGSFHSNDLFLDAQL
Assay Information GIMAP5 Blocking Peptide, catalog no. 33R-1678, is also available for use as a blocking control in assays to test for specificity of this GIMAP5 antibody

Images

Western Blot analysis using GIMAP5 antibody (70R-6383)

GIMAP5 antibody (70R-6383) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GIMAP5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GIMAP5 belongs to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GIMAP5 antibody (70R-6383) | GIMAP5 antibody (70R-6383) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors