GINS2 antibody (70R-5625)

Rabbit polyclonal GINS2 antibody

Synonyms Polyclonal GINS2 antibody, Anti-GINS2 antibody, GINS-2 antibody, Pfs2 antibody, GINS 2 antibody, HSPC037 antibody, Gins Complex Subunit 2 antibody, PSF2 antibody, GINS-2, Psf2 Homolog antibody, GINS 2, GINS2
Cross Reactivity Human
Applications WB
Immunogen GINS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAIN
Assay Information GINS2 Blocking Peptide, catalog no. 33R-1841, is also available for use as a blocking control in assays to test for specificity of this GINS2 antibody

Images

Western Blot analysis using GINS2 antibody (70R-5625)

GINS2 antibody (70R-5625) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GINS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The yeast heterotetrameric GINS complex is made up of Sld5, Psf1, Psf2, and Psf3. The formation of this complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GINS2 antibody (70R-5625) | GINS2 antibody (70R-5625) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors