GIPC1 antibody (70R-4857)

Rabbit polyclonal GIPC1 antibody raised against the N terminal of GIPC1

Synonyms Polyclonal GIPC1 antibody, Anti-GIPC1 antibody, GIPC 1, GIPC-1, Gipc Pdz Domain Containing Family Member 1 antibody, GIPC-1 antibody, GIPC1, GIPC 1 antibody
Specificity GIPC1 antibody was raised against the N terminal of GIPC1
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications WB
Immunogen GIPC1 antibody was raised using the N terminal of GIPC1 corresponding to a region with amino acids SGGPQMGLPPPPPALRPRLVFHTQLAHGSPTGRIEGFTNVKELYGKIAEA
Assay Information GIPC1 Blocking Peptide, catalog no. 33R-8461, is also available for use as a blocking control in assays to test for specificity of this GIPC1 antibody


Western Blot analysis using GIPC1 antibody (70R-4857)

GIPC1 antibody (70R-4857) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GIPC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GIPC1 belongs to the GIPC family. It may be involved in G protein-linked signaling.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GIPC1 antibody (70R-4857) | GIPC1 antibody (70R-4857) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors