GIPC2 antibody (70R-1216)

Rabbit polyclonal GIPC2 antibody raised against the N terminal of GIPC2

Synonyms Polyclonal GIPC2 antibody, Anti-GIPC2 antibody, GIPC 2 antibody, Gipc Pdz Domain Containing Family Member 2 antibody, GIPC2, GIPC-2 antibody, GIPC-2, GIPC 2
Specificity GIPC2 antibody was raised against the N terminal of GIPC2
Cross Reactivity Human
Applications IHC, WB
Immunogen GIPC2 antibody was raised using the N terminal of GIPC2 corresponding to a region with amino acids MPLKLRGKKKAKSKETAGLVEGEPTGAGGGSLSASRAPARRLVFHAQLAH
Assay Information GIPC2 Blocking Peptide, catalog no. 33R-6291, is also available for use as a blocking control in assays to test for specificity of this GIPC2 antibody

Images

Immunohistochemical staining using GIPC2 antibody (70R-1216)

GIPC2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of GIPC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GIPC1/GIPC, GIPC2, and GIPC3 are a family of central PDZ-domain proteins. GIPC2 might play important roles in human gastric cancer through modulation of growth factor signaling or cell adhesion. GIPC1, GIPC2 and GIPC3 might play key roles in carcinogenesis and embryogenesis through modulation of growth factor signaling and cell adhesion.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using GIPC2 antibody (70R-1216) | GIPC2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using GIPC2 antibody (70R-1216) | GIPC2 antibody (70R-1216) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors