GJA1 antibody (70R-6088)

Rabbit polyclonal GJA1 antibody raised against the N terminal of GJA1

Synonyms Polyclonal GJA1 antibody, Anti-GJA1 antibody, GJA-1, Gap Junction Protein Alpha 1 43Kda antibody, GJA 1, GJA1, GJA-1 antibody, GJA 1 antibody
Specificity GJA1 antibody was raised against the N terminal of GJA1
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen GJA1 antibody was raised using the N terminal of GJA1 corresponding to a region with amino acids LYLAHVFYVMRKEEKLNKKEEELKVAQTDGVNVDMHLKQIEIKKFKYGIE
Assay Information GJA1 Blocking Peptide, catalog no. 33R-5566, is also available for use as a blocking control in assays to test for specificity of this GJA1 antibody


Western Blot analysis using GJA1 antibody (70R-6088)

GJA1 antibody (70R-6088) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GJA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Gap junction protein, alpha 1 is a member of the connexin gene family and a component of gap junctions. Gap junctions are composed of arrays of intercellular channels and provide a route for the diffusion of materials of low molecular weight from cell to cell. Connexin 43 is the major protein of gap junctions in the heart, and gap junctions are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GJA1 antibody (70R-6088) | GJA1 antibody (70R-6088) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors