GJA3 antibody (70R-6101)

Rabbit polyclonal GJA3 antibody raised against the N terminal of GJA3

Synonyms Polyclonal GJA3 antibody, Anti-GJA3 antibody, CZP3 antibody, GJA-3, Gap Junction Protein Alpha 3 46Kda antibody, CX46 antibody, GJA 3 antibody, GJA 3, GJA-3 antibody, GJA3
Specificity GJA3 antibody was raised against the N terminal of GJA3
Cross Reactivity Human
Applications WB
Immunogen GJA3 antibody was raised using the N terminal of GJA3 corresponding to a region with amino acids ISHIRFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEEEQLKRESPS
Assay Information GJA3 Blocking Peptide, catalog no. 33R-4153, is also available for use as a blocking control in assays to test for specificity of this GJA3 antibody

Images

Western Blot analysis using GJA3 antibody (70R-6101)

GJA3 antibody (70R-6101) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GJA3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GJA3 belongs to the connexin family. One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Defects in GJA3 are the cause of zonular pulverulent cataract type 3 (CZP3).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GJA3 antibody (70R-6101) | GJA3 antibody (70R-6101) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors