GJA4 antibody (70R-6111)

Rabbit polyclonal GJA4 antibody raised against the middle region of GJA4

Synonyms Polyclonal GJA4 antibody, Anti-GJA4 antibody, GJA4, Gap Junction Protein Alpha 4 37Kda antibody, GJA-4, GJA-4 antibody, CX37 antibody, GJA 4, GJA 4 antibody
Specificity GJA4 antibody was raised against the middle region of GJA4
Cross Reactivity Human
Applications WB
Immunogen GJA4 antibody was raised using the middle region of GJA4 corresponding to a region with amino acids QKEGELRALPAKDPQVERALAAVERQMAKISVAEDGRLRIRGALMGTYVA
Assay Information GJA4 Blocking Peptide, catalog no. 33R-7598, is also available for use as a blocking control in assays to test for specificity of this GJA4 antibody

Images

Western Blot analysis using GJA4 antibody (70R-6111)

GJA4 antibody (70R-6111) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GJA4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GJA4 is a member of the connexin family. The protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Mutations in this gene have been associated with atherosclerosis and a higher risk of myocardial infarction.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GJA4 antibody (70R-6111) | GJA4 antibody (70R-6111) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors