GJA5 antibody (70R-6109)

Rabbit polyclonal GJA5 antibody raised against the N terminal of GJA5

Synonyms Polyclonal GJA5 antibody, Anti-GJA5 antibody, GJA5, GJA 5 antibody, GJA-5 antibody, GJA-5, GJA 5, Gap Junction Protein Alpha 5 40Kda antibody
Specificity GJA5 antibody was raised against the N terminal of GJA5
Cross Reactivity Human
Applications WB
Immunogen GJA5 antibody was raised using the N terminal of GJA5 corresponding to a region with amino acids STPSLVYMGHAMHTVRMQEKRKLREAERAKEVRGSGSYEYPVAEKAELSC
Assay Information GJA5 Blocking Peptide, catalog no. 33R-8882, is also available for use as a blocking control in assays to test for specificity of this GJA5 antibody

Images

Western Blot analysis using GJA5 antibody (70R-6109)

GJA5 antibody (70R-6109) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GJA5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GJA5 belongs to the connexin family, alpha-type subfamily. It is an integral membrane protein that forms transmembrane channels, and may function in small molecule transport, muscle contraction and cell-cell communication. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GJA5 antibody (70R-6109) | GJA5 antibody (70R-6109) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors