GJB1 antibody (70R-6122)

Rabbit polyclonal GJB1 antibody raised against the middle region of GJB1

Synonyms Polyclonal GJB1 antibody, Anti-GJB1 antibody, GJB 1 antibody, GJB-1, CX32 antibody, CMTX1 antibody, GJB1, GJB 1, Gap Junction Protein Beta 1 32Kda antibody, CMTX antibody, GJB-1 antibody
Specificity GJB1 antibody was raised against the middle region of GJB1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GJB1 antibody was raised using the middle region of GJB1 corresponding to a region with amino acids RACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILR
Assay Information GJB1 Blocking Peptide, catalog no. 33R-7802, is also available for use as a blocking control in assays to test for specificity of this GJB1 antibody

Images

Immunohistochemical staining using GJB1 antibody (70R-6122)

Skin

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GJB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the gap junction protein family. The gap junction proteins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using GJB1 antibody (70R-6122) | Skin
  • Western blot analysis using GJB1 antibody (70R-6122) | Recommended GJB1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors