GJB6 antibody (70R-6097)

Rabbit polyclonal GJB6 antibody raised against the middle region of GJB6

Synonyms Polyclonal GJB6 antibody, Anti-GJB6 antibody, GJB-6, CX30 antibody, GJB-6 antibody, HED antibody, Gap Junction Protein Beta 6 30Kda antibody, GJB6, EDH antibody, GJB 6 antibody, GJB 6, DFNA3 antibody, ED2 antibody
Specificity GJB6 antibody was raised against the middle region of GJB6
Cross Reactivity Human
Applications WB
Immunogen GJB6 antibody was raised using the middle region of GJB6 corresponding to a region with amino acids CYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFP
Assay Information GJB6 Blocking Peptide, catalog no. 33R-1835, is also available for use as a blocking control in assays to test for specificity of this GJB6 antibody

Images

Western Blot analysis using GJB6 antibody (70R-6097)

GJB6 antibody (70R-6097) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GJB6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Gap junctions allow the transport of ions and metabolites between the cytoplasm of adjacent cells. They are formed by two hemichannels, made up of six connexin proteins assembled in groups. Each connexin protein has four transmembrane segments.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GJB6 antibody (70R-6097) | GJB6 antibody (70R-6097) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors