GJC1 antibody (70R-6189)

Rabbit polyclonal GJC1 antibody raised against the middle region of GJC1

Synonyms Polyclonal GJC1 antibody, Anti-GJC1 antibody, GJC1, DKFZp686P0738 antibody, GJC-1, GJC 1 antibody, CX45 antibody, GJC-1 antibody, GJA7 antibody, GJC 1, Gap Junction Protein Gamma 1 45Kda antibody
Specificity GJC1 antibody was raised against the middle region of GJC1
Cross Reactivity Human
Applications WB
Immunogen GJC1 antibody was raised using the middle region of GJC1 corresponding to a region with amino acids ERLDLAVQAYSHQNNPHGPREKKAKVGSKAGSNKSTASSKSGDGKTSVWI
Assay Information GJC1 Blocking Peptide, catalog no. 33R-2698, is also available for use as a blocking control in assays to test for specificity of this GJC1 antibody

Images

Western Blot analysis using GJC1 antibody (70R-6189)

GJC1 antibody (70R-6189) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GJC1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GJC1 is a member of the connexin family. The protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Alternatively spliced transcript variants encoding the same isoform have been described.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GJC1 antibody (70R-6189) | GJC1 antibody (70R-6189) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors