GJC2 antibody (70R-6170)

Rabbit polyclonal GJC2 antibody raised against the middle region of GJC2

Synonyms Polyclonal GJC2 antibody, Anti-GJC2 antibody, GJC 2 antibody, Gap Junction Protein Gamma 2 47Kda antibody, GJC-2, GJC 2, GJA12 antibody, GJC-2 antibody, PMLDAR antibody, GJC2, Cx47 antibody, CX46.6 antibody, MGC105119 antibody
Specificity GJC2 antibody was raised against the middle region of GJC2
Cross Reactivity Human
Applications WB
Immunogen GJC2 antibody was raised using the middle region of GJC2 corresponding to a region with amino acids APASRTGSATSAGTVGEQGRPGTHERPGAKPRAGSEKGSASSRDGKTTVW
Assay Information GJC2 Blocking Peptide, catalog no. 33R-1416, is also available for use as a blocking control in assays to test for specificity of this GJC2 antibody

Images

Western Blot analysis using GJC2 antibody (70R-6170)

GJC2 antibody (70R-6170) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GJC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GJC2 is a gap junction protein. Gap junction proteins are members of a large family of homologous connexins and comprise 4 transmembrane, 2 extracellular, and 3 cytoplasmic domains. This gene plays a key role in central myelination and is involved in peripheral myelination in humans.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GJC2 antibody (70R-6170) | GJC2 antibody (70R-6170) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors