GJD2 antibody (70R-6161)

Rabbit polyclonal GJD2 antibody raised against the middle region of GJD2

Synonyms Polyclonal GJD2 antibody, Anti-GJD2 antibody, MGC138315 antibody, GJD-2 antibody, GJD 2, CX36 antibody, MGC138319 antibody, GJA9 antibody, Gap Junction Protein Delta 2 36Kda antibody, GJD 2 antibody, GJD-2, GJD2
Specificity GJD2 antibody was raised against the middle region of GJD2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GJD2 antibody was raised using the middle region of GJD2 corresponding to a region with amino acids ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY
Assay Information GJD2 Blocking Peptide, catalog no. 33R-2564, is also available for use as a blocking control in assays to test for specificity of this GJD2 antibody

Images

Western Blot analysis using GJD2 antibody (70R-6161)

GJD2 antibody (70R-6161) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GJD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GJD2 is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GJD2 antibody (70R-6161) | GJD2 antibody (70R-6161) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors