GLIPR1L1 antibody (70R-4567)

Rabbit polyclonal GLIPR1L1 antibody raised against the middle region of GLIPR1L1

Synonyms Polyclonal GLIPR1L1 antibody, Anti-GLIPR1L1 antibody, Gli Pathogenesis-Related 1 Like 1 antibody, ALKN2972 antibody, PRO7434 antibody, MGC26856 antibody
Specificity GLIPR1L1 antibody was raised against the middle region of GLIPR1L1
Cross Reactivity Human
Applications WB
Immunogen GLIPR1L1 antibody was raised using the middle region of GLIPR1L1 corresponding to a region with amino acids NMPPYVRGESCSLCSKEEKCVKNLCKNPFLKPTGRAPQQTAFNPFSLGFL
Assay Information GLIPR1L1 Blocking Peptide, catalog no. 33R-6798, is also available for use as a blocking control in assays to test for specificity of this GLIPR1L1 antibody


Western Blot analysis using GLIPR1L1 antibody (70R-4567)

GLIPR1L1 antibody (70R-4567) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GLIPR1L1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GLIPR1L1 is a novel testis-specific CAP protein and is presented to the acrosomal cap following in vitro capacitation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GLIPR1L1 antibody (70R-4567) | GLIPR1L1 antibody (70R-4567) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors