GLRX5 antibody (70R-3854)

Rabbit polyclonal GLRX5 antibody raised against the middle region of GLRX5

Synonyms Polyclonal GLRX5 antibody, Anti-GLRX5 antibody, PR01238 antibody, GLRX 5, PRO1238 antibody, C14orf87 antibody, GRX5 antibody, Glutaredoxin 5 antibody, FLB4739 antibody, MGC14129 antibody, GLRX 5 antibody, GLRX-5, GLRX-5 antibody, GLRX5
Specificity GLRX5 antibody was raised against the middle region of GLRX5
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GLRX5 antibody was raised using the middle region of GLRX5 corresponding to a region with amino acids NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG
Assay Information GLRX5 Blocking Peptide, catalog no. 33R-6648, is also available for use as a blocking control in assays to test for specificity of this GLRX5 antibody

Images

Western Blot analysis using GLRX5 antibody (70R-3854)

GLRX5 antibody (70R-3854) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GLRX5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Defects in GLRX5 are the cause of anemia sideroblastic pyridoxine-refractory autosomal recessive (PRARSA). The specific function of GLRX5 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GLRX5 antibody (70R-3854) | GLRX5 antibody (70R-3854) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors