GLT6D1 antibody (70R-2206)

Rabbit polyclonal GLT6D1 antibody raised against the middle region of GLT6D1

Synonyms Polyclonal GLT6D1 antibody, Anti-GLT6D1 antibody, GLTDC1 antibody, GLT6, GLT-6 antibody, Glycosyltransferase 6 Domain Containing 1 antibody, GLT 6 antibody, GLT-6, GLT 6
Specificity GLT6D1 antibody was raised against the middle region of GLT6D1
Cross Reactivity Human
Applications WB
Immunogen GLT6D1 antibody was raised using the middle region of GLT6D1 corresponding to a region with amino acids FGVETLGPLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLM
Assay Information GLT6D1 Blocking Peptide, catalog no. 33R-2916, is also available for use as a blocking control in assays to test for specificity of this GLT6D1 antibody

Images

Western Blot analysis using GLT6D1 antibody (70R-2206)

GLT6D1 antibody (70R-2206) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GLT6D1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GLT6D1 is a single-pass type II membrane protein. It belongs to the glycosyltransferase 6 family. The exact function of GLT6D1 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GLT6D1 antibody (70R-2206) | GLT6D1 antibody (70R-2206) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors