GLT8D1 antibody (70R-6824)

Rabbit polyclonal GLT8D1 antibody raised against the middle region of GLT8D1

Synonyms Polyclonal GLT8D1 antibody, Anti-GLT8D1 antibody, DKFZp781O20198 antibody, MSTP139 antibody, GLT 8 antibody, Glycosyltransferase 8 Domain Containing 1 antibody, GLT-8, FLJ14611 antibody, AD-017 antibody, GLT 8, GLT-8 antibody, GLT8
Specificity GLT8D1 antibody was raised against the middle region of GLT8D1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen GLT8D1 antibody was raised using the middle region of GLT8D1 corresponding to a region with amino acids LLIVFYQQHSTIDPMWNVRHLGSSAGKRYSPQFVKAAKLLHWNGHLKPWG
Assay Information GLT8D1 Blocking Peptide, catalog no. 33R-5151, is also available for use as a blocking control in assays to test for specificity of this GLT8D1 antibody

Images

Western Blot analysis using GLT8D1 antibody (70R-6824)

GLT8D1 antibody (70R-6824) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GLT8D1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GLT8D1 is a member of the glycosyltransferase family. The specific function of this protein has not been determined. Three alternatively spliced variants encoding the same isoform have been described.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GLT8D1 antibody (70R-6824) | GLT8D1 antibody (70R-6824) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors