Glucagon antibody (70R-6207)

Rabbit polyclonal Glucagon antibody raised against the middle region of GCG

Synonyms Polyclonal Glucagon antibody, Anti-Glucagon antibody, GLP2 antibody, GCG antibody, GLP1 antibody, GRPP antibody
Specificity Glucagon antibody was raised against the middle region of GCG
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Glucagon antibody was raised using the middle region of GCG corresponding to a region with amino acids VSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMN
Assay Information Glucagon Blocking Peptide, catalog no. 33R-9829, is also available for use as a blocking control in assays to test for specificity of this Glucagon antibody

Images

Western Blot analysis using Glucagon antibody (70R-6207)

Glucagon antibody (70R-6207) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 4 kDa (MW of target protein)
Form & Buffer Glucagon antibody is supplied as lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GCG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Secreted in the pancreas, Glucagon exerts the opposite influence to insulin, in that glucagon is responsible for raising blood glucose levels. Glucagon is released from the pancreas when blood sugar (glucose) levels become depleted. Glucagon causes the liver to convert stored glycogen into glucose, which is released into the bloodstream.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Glucagon antibody (70R-6207) | Glucagon antibody (70R-6207) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors