GLUD2 antibody (70R-3791)

Rabbit polyclonal GLUD2 antibody raised against the N terminal of GLUD2

Synonyms Polyclonal GLUD2 antibody, Anti-GLUD2 antibody, GLUD2, Glutamate Dehydrogenase 2 antibody, GLUD 2 antibody, GLUD 2, GLUD-2, GLUDP1 antibody, GDH2 antibody, GLUD-2 antibody
Specificity GLUD2 antibody was raised against the N terminal of GLUD2
Cross Reactivity Human
Applications WB
Immunogen GLUD2 antibody was raised using the N terminal of GLUD2 corresponding to a region with amino acids MYRYLAKALLPSRAGPAALGSAANHSAALLGRGRGQPAAASQPGLALAAR
Assay Information GLUD2 Blocking Peptide, catalog no. 33R-6630, is also available for use as a blocking control in assays to test for specificity of this GLUD2 antibody


Western Blot analysis using GLUD2 antibody (70R-3791)

GLUD2 antibody (70R-3791) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GLUD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Glutamate dehydrogenase (EC catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate using NAD and/or NADP as cofactors.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GLUD2 antibody (70R-3791) | GLUD2 antibody (70R-3791) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors