GLUT10 antibody (70R-1763)

Rabbit polyclonal GLUT10 antibody

Synonyms Polyclonal GLUT10 antibody, Anti-GLUT10 antibody, Facilitated Glucose Transporter 10 antibody, GLUT 10 antibody, GLUT10, SLC2A10 antibody, GLUT-10, Glucose transporter 10 antibody, GLUT-10 antibody, GLUT 10, Solute Carrier Family 2 Member 10 antibody
Cross Reactivity Human
Applications WB
Immunogen GLUT10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKKTKPHPRSGDPSAPPRLALSSALPGPPLPARGHALLRWTALLCLMVFV
Assay Information GLUT10 Blocking Peptide, catalog no. 33R-1299, is also available for use as a blocking control in assays to test for specificity of this GLUT10 antibody


Western Blot analysis using GLUT10 antibody (70R-1763)

GLUT10 antibody (70R-1763) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC2A10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC2A10 is a member of the facilitative glucose transporter family, which plays a significant role in maintaining glucose homeostasis.SLC2A10 is a member of the facilitative glucose transporter family, which plays a significant role in maintaining glucose homeostasis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using GLUT10 antibody (70R-1763) | GLUT10 antibody (70R-1763) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors