GLUT13 antibody (70R-6427)

Rabbit polyclonal GLUT13 antibody

Synonyms Polyclonal GLUT13 antibody, Anti-GLUT13 antibody, GLUT-13, SLC2A13 antibody, Solute Carrier Family 2 Member 13 antibody, MGC48624 antibody, GLUT 13, GLUT-13 antibody, GLUT 13 antibody, Glucose transporter 13 antibody, GLUT13, Facilitated Glucose Transporter 13 antibody
Cross Reactivity Human
Applications WB
Immunogen GLUT13 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSLAGTTVALIILALGFVLSAQVSPRITFKPIAPSGQNATCTRYSYCNEC
Assay Information GLUT13 Blocking Peptide, catalog no. 33R-3572, is also available for use as a blocking control in assays to test for specificity of this GLUT13 antibody

Images

Western Blot analysis using GLUT13 antibody (70R-6427)

GLUT13 antibody (70R-6427) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC2A13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC2A13 is an H (+)-myo-inositol cotransporter. It can also transport related stereoisomers.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GLUT13 antibody (70R-6427) | GLUT13 antibody (70R-6427) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors