GLUT2 antibody (70R-7306)

Rabbit polyclonal GLUT2 antibody

Synonyms Polyclonal GLUT2 antibody, Anti-GLUT2 antibody, Glucose transporter 2 antibody, SLC2A2 antibody, GLUT-2, GLUT2, Solute Carrier Family 2 Member 2 antibody, Facilitated Glucose Transporter 2 antibody, GLUT-2 antibody, GLUT 2 antibody, GLUT 2
Cross Reactivity Human,Mouse
Applications WB
Immunogen GLUT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINST
Assay Information GLUT2 Blocking Peptide, catalog no. 33R-4171, is also available for use as a blocking control in assays to test for specificity of this GLUT2 antibody

Images

Western Blot analysis using GLUT2 antibody (70R-7306)

GLUT2 antibody (70R-7306) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC2A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Glucose transporter 2 isoform is an integral plasma membrane glycoprotein of the liver, islet beta cells, intestine, and kidney epithelium. It mediates facilitated bidirectional glucose transport. Because of its low affinity for glucose, it has been suggested as a glucose sensor.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GLUT2 antibody (70R-7306) | GLUT2 antibody (70R-7306) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors