GLUT4 antibody (70R-6693)

Rabbit polyclonal GLUT4 antibody

Synonyms Polyclonal GLUT4 antibody, Anti-GLUT4 antibody, GLUT-4 antibody, Glucose transporter 4 antibody, Solute Carrier Family 2 Member 4 antibody, GLUT4, GLUT-4, Facilitated Glucose Transporter 4 antibody, GLUT 4 antibody, GLUT 4, SLC2A4 antibody
Cross Reactivity Human
Applications WB
Immunogen GLUT4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LQFGYNIGVINAPQKVIEQSYNETWLGRQGPEGPSSIPPGTLTTLWALSV
Assay Information GLUT4 Blocking Peptide, catalog no. 33R-5310, is also available for use as a blocking control in assays to test for specificity of this GLUT4 antibody

Images

Western Blot analysis using GLUT4 antibody (70R-6693)

GLUT4 antibody (70R-6693) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC2A4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC2A4 is a member of the solute carrier family 2 (facilitated glucose transporter) family and functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GLUT4 antibody (70R-6693) | GLUT4 antibody (70R-6693) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors