GLUT5 antibody (70R-7547)

Rabbit polyclonal GLUT5 antibody

Synonyms Polyclonal GLUT5 antibody, Anti-GLUT5 antibody, Glucose transporter 5 antibody, GLUT 5, GLUT-5, Solute Carrier Family 2 Member 5 antibody, Facilitated Glucose/Fructose Transporter 5 antibody, GLUT-5 antibody, GLUT5, SLC2A5 antibody, GLUT 5 antibody
Cross Reactivity Human
Applications WB
Immunogen GLUT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGF
Assay Information GLUT5 Blocking Peptide, catalog no. 33R-1101, is also available for use as a blocking control in assays to test for specificity of this GLUT5 antibody

Images

Western Blot analysis using GLUT5 antibody (70R-7547)

GLUT5 antibody (70R-7547) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC2A5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC2A5 is a cytochalasin B-sensitive carrier. It seems to function primarily as a fructose transporter.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GLUT5 antibody (70R-7547) | GLUT5 antibody (70R-7547) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors