GLUT5 Blocking Peptide (33R-1101)

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC2A5 antibody, catalog no. 70R-7547

Synonyms GLUT5 control peptide, GLUT5 antibody Blocking Peptide, Anti-GLUT5 Blocking Peptide, Solute Carrier Family 2 Member 5 Blocking Peptide, Facilitated Glucose/Fructose Transporter 5 Blocking Peptide, SLC2A5 Blocking Peptide, Glucose transporter 5 Blocking Peptide, GLUT5, GLUT-5, GLUT 5, GLUT-5 Blocking Peptide, GLUT 5 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ADQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGF
Molecular Weight 55 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC2A5 is a cytochalasin B-sensitive carrier. It seems to function primarily as a fructose transporter.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors