GLUT6 antibody (70R-6551)

Rabbit polyclonal GLUT6 antibody

Synonyms Polyclonal GLUT6 antibody, Anti-GLUT6 antibody, HSA011372 antibody, Solute Carrier Family 2 Member 6 antibody, GLUT 6 antibody, GLUT-6, SLC2A6 antibody, GLUT-6 antibody, GLUT6, Facilitated Glucose Transporter 6 antibody, GLUT 6, GLUT9 antibody, Glucose transporter 6 antibody
Cross Reactivity Human
Applications WB
Immunogen GLUT6 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFLATFAAVLGNFSFGYALVYTSPVIPALERSLDPDLHLTKSQASWFGSV
Assay Information GLUT6 Blocking Peptide, catalog no. 33R-9532, is also available for use as a blocking control in assays to test for specificity of this GLUT6 antibody

Images

Western Blot analysis using GLUT6 antibody (70R-6551)

GLUT6 antibody (70R-6551) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC2A6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Hexose transport into mammalian cells is catalyzed by a family of membrane proteins, including SLC2A6, which contains 12 transmembrane domains and a number of critical conserved residues.Hexose transport into mammalian cells is catalyzed by a family of membrane proteins, including SLC2A6, that contain 12 transmembrane domains and a number of critical conserved residues.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GLUT6 antibody (70R-6551) | GLUT6 antibody (70R-6551) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors