GLUT6 Blocking Peptide (33R-1039)

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC2A6 antibody, catalog no. 70R-1796

Synonyms GLUT6 control peptide, GLUT6 antibody Blocking Peptide, Anti-GLUT6 Blocking Peptide, Solute Carrier Family 2 Member 6 Blocking Peptide, Facilitated Glucose Transporter 6 Blocking Peptide, SLC2A6 Blocking Peptide, Glucose transporter 6 Blocking Peptide, GLUT9 Blocking Peptide, HSA011372 Blocking Peptide, GLUT6, GLUT-6, GLUT 6, GLUT-6 Blocking Peptide, GLUT 6 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLL
Molecular Weight 56 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Hexose transport into mammalian cells is catalyzed by a family of membrane proteins, including SLC2A6, which contains 12 transmembrane domains and a number of critical conserved residues.Hexose transport into mammalian cells is catalyzed by a family of membrane proteins, including SLC2A6, that contain 12 transmembrane domains and a number of critical conserved residues.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors