GLUT9 antibody (70R-6330)

Rabbit polyclonal GLUT9 antibody

Synonyms Polyclonal GLUT9 antibody, Anti-GLUT9 antibody, Solute Carrier Family 2 Member 9 antibody, GLUT 9, GLUTX antibody, Glucose transporter 9 antibody, GLUT9, Facilitated Glucose Transporter 9 antibody, GLUT 9 antibody, SLC2A9 antibody, GLUT-9 antibody, GLUT-9
Cross Reactivity Human
Applications WB
Immunogen GLUT9 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPPAKIPYVTLSTGGIETL
Assay Information GLUT9 Blocking Peptide, catalog no. 33R-9899, is also available for use as a blocking control in assays to test for specificity of this GLUT9 antibody

Images

Western Blot analysis using GLUT9 antibody (70R-6330)

GLUT9 antibody (70R-6330) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC2A9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC2A9 is a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. SLC2A9 may play a role in the development and survival of chondrocytes in cartilage matrices.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using GLUT9 antibody (70R-6330) | GLUT9 antibody (70R-6330) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors