Glycoprotein antibody (70R-6282)

Rabbit polyclonal Glycoprotein antibody

Synonyms Polyclonal Glycoprotein antibody, Anti-Glycoprotein antibody, Transmembrane Nmb antibody, NMB antibody, GPNMB antibody, HGFIN antibody
Cross Reactivity Human, Mouse
Applications WB
Immunogen Glycoprotein antibody was raised using a synthetic peptide corresponding to a region with amino acids DGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSV
Assay Information Glycoprotein Blocking Peptide, catalog no. 33R-1947, is also available for use as a blocking control in assays to test for specificity of this Glycoprotein antibody

Images

Western Blot analysis using Glycoprotein antibody (70R-6282)

Glycoprotein antibody (70R-6282) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPNMB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GPNMB is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Glycoprotein antibody (70R-6282) | Glycoprotein antibody (70R-6282) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors