Glycoprotein antibody (70R-7158)

Rabbit polyclonal Glycoprotein antibody

Synonyms Polyclonal Glycoprotein antibody, Anti-Glycoprotein antibody, NMB antibody, GPNMB antibody, HGFIN antibody, Transmembrane Nmb antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen Glycoprotein antibody was raised using a synthetic peptide corresponding to a region with amino acids KGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNE
Assay Information Glycoprotein Blocking Peptide, catalog no. 33R-4393, is also available for use as a blocking control in assays to test for specificity of this Glycoprotein antibody

Images

Immunohistochemical staining using Glycoprotein antibody (70R-7158)

Glycoprotein antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GPNMB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GPNMB is a type I transmembrane glycoprotein which shows homology to the pMEL17 precursor, a melanocyte-specific protein. GPNMB shows expression in the lowly metastatic human melanoma cell lines and xenografts but does not show expression in the highly metastatic cell lines. GPNMB may be involved in growth delay and reduction of metastatic potential.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using Glycoprotein antibody (70R-7158) | Glycoprotein antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using Glycoprotein antibody (70R-7158) | Glycoprotein antibody (70R-7158) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors