Glycoprotein VI antibody (70R-7316)

Rabbit polyclonal Glycoprotein VI antibody

Synonyms Polyclonal Glycoprotein VI antibody, Anti-Glycoprotein VI antibody, MGC138168 antibody, GPIV antibody, GP6 antibody, GPVI antibody
Cross Reactivity Human
Applications WB
Immunogen Glycoprotein VI antibody was raised using a synthetic peptide corresponding to a region with amino acids PPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYY
Assay Information Glycoprotein VI Blocking Peptide, catalog no. 33R-7278, is also available for use as a blocking control in assays to test for specificity of this Glycoprotein VI antibody

Images

Western Blot analysis using Glycoprotein VI antibody (70R-7316)

Glycoprotein VI antibody (70R-7316) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of GP6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Glycoprotein VI (GP6) is a 58 kDa platelet membrane glycoprotein that plays a crucial role in the collagen-induced activation and aggregation of platelets. Collagen receptor involved in collagen-induced platelet adhesion and activation. GP6 plays a key role in platelet procoagulant activity and subsequent thrombin and fibrin formation. This procoagulant function may contribute to arterial and venous thrombus formation. The signaling pathway involves the FcR gamma-chain, the Src kinases (likely Fyn/Lyn), the adapter protein LAT and leads to the activation of phospholipase C gamma2.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Glycoprotein VI antibody (70R-7316) | Glycoprotein VI antibody (70R-7316) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors